General Information

  • ID:  hor003298
  • Uniprot ID:  O35417
  • Protein name:  Leu-enkephalin
  • Gene name:  Pdyn
  • Organism:  Mus musculus (Mouse)
  • Family:  Opioid neuropeptide precursor family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Mus (subgenus), Mus (genus), Murinae (subfamily), Muridae (family), Muroidea, Myomorpha (suborder), Rodentia (order), Glires, Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0001515 opioid peptide activity; GO:0005184 neuropeptide hormone activity; GO:0031628 opioid receptor binding
  • GO BP:  GO:0007218 neuropeptide signaling pathway; GO:0007268 chemical synaptic transmission; GO:0007600 sensory perception
  • GO CC:  GO:0005576 extracellular region; GO:0005886 plasma membrane; GO:0008021 synaptic vesicle; GO:0030425 dendrite; GO:0043025 neuronal cell body; GO:0043679 axon terminus; GO:0098686 hippocampal mossy fiber to CA3 synapse; GO:0098992 neuronal dense core vesicle; GO:0099013 neuronal dense core vesicle lumen

Sequence Information

  • Sequence:  YGGFL
  • Length:  5(166-170)
  • Propeptide:  MAWSRLMLAACLLVMPSNVMADCLSLCSLCAVRIQDGPRPINPLICSLECQDLVPPSEEWETCRGFSSFLTLTVSGLRGKDDLEDEVALEEGISAHAKLLEPVLKELEKSRLLTSVPEEKFRGLSSSFGNGKESELAGADRMNDEAAQGRTVHFNEEDLRKQAKRYGGFLRKYPKRSSEMARDEDGGQDGDQVGHEDLYKRYGGFLRRIRPKLKWDNQKRYGGFLRRQFKVVTRSQENPNTYSEDLDV
  • Signal peptide:  MAWSRLMLAACLLVMPSNVMA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Compete with and mimic the effects of opiate drugs. They play a role in a number of physiologic functions, including pain perception and responses to stress.
  • Mechanism:  NA
  • Cross BBB:  YES
  • Target:  Oprk1
  • Target Unid:  P33534
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: 1279 seconds ( PubMed ID: 12444298 )

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-O35417-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor003298_AF2.pdbhor003298_ESM.pdb

Physical Information

Mass: 62716 Formula: C28H37N5O7
Absent amino acids: ACDEHIKMNPQRSTVW Common amino acids: G
pI: 6.09 Basic residues: 0
Polar residues: 3 Hydrophobic residues: 2
Hydrophobicity: 90 Boman Index: 964
Half-Life: 2.8 hour Half-Life Yeast: 10 min
Half-Life E.Coli: 2 min Aliphatic Index 78
Instability Index: 1570 Extinction Coefficient cystines: 1490
Absorbance 280nm: 372.5

Literature